Tap / click on image to see more RealViewsTM
$122.00
per dartboard
 

White, Pirate Flag Calico Jack, Skull & Cutlass Dartboard

Qty:

Other designs from this category

About Dartboards

Sold by

Size: ProfiledInk Dart Board

Bull's-eye! Create the perfect custom dart board. Featuring vibrant colour printing, this regulation size dart board is easily customised with your images, text and designs for a great gift or the perfect addition to your game room. Made to your exact specifications, this dart board will hit its mark!

  • Dimensions: 45.7 cm diameter, 2.5 cm h; regulation size board
  • Includes 6 brass darts (3 American flag dart flights and 3 UK dart flights)
  • Vibrant, full-colour printing
  • Finished with aluminium frame and hanging hook

This product is recommended for ages 14+..
Creator Tip: To ensure the highest quality print, please note that this product's customisable design area measures 44.4 cm x 444 cm.

About This Design

White, Pirate Flag Calico Jack, Skull & Cutlass Dartboard

White, Pirate Flag Calico Jack, Skull & Cutlass Dartboard

A low growl rumbled across the waves, not from the storm brewing on the horizon, but from Captain Jack's throat. His dark eyes, usually gleaming with mischief, held a steely glint as he surveyed the approaching ship. The "Revenge," his sloop, heeled slightly in the choppy water, its black hull a stark contrast to the dawn's pale light. --- "Spanish merchantman, by the looks of it," rasped Old Bill, the grizzled bosun, his weathered face etched with years at sea. "Fat belly, ripe for the plucking." --- A slow smile spread across Jack's face, as cold and sharp as the cutlass hanging from his hip. Unlike other captains who revelled in open brawls, Jack preferred a more theatrical approach. He wasn't interested in just plunder; he craved the delicious terror that preceded it. --- "Hold the sails, lads," he called out, his voice surprisingly calm amidst the rising tension. "Let them get a good look at us." --- The crew, a motley bunch of cutthroats and dreamers, exchanged knowing glances. This wasn't their first rodeo. Below deck, the nimble powder monkeys scurried about, ensuring a smooth flow of ammunition, while the gunners readied their cannons with practiced ease. --- The unsuspecting merchant ship, the "El Dorado," drew closer, its white sails catching the first rays of the hesitant sun. A band of musicians played a cheerful tune, a stark contrast to the grim silence aboard the "Revenge." --- Suddenly, with a flourish, Jack raised a hand. The tattered French flag they'd been flying dipped down, revealing a sight that sent shivers down the spines of even the most hardened pirates; the Jolly Roger. Its stark white skull, leering with empty sockets, seemed to mock the approaching vessel. Below the skull, crossed cutlasses gleamed with a deadly promise. --- A collective gasp echoed from the "El Dorado." The music died down, replaced by an awful, suffocating silence. The festive air vanished, replaced by a thick fog of terror. Even the seasoned sailors of the "El Dorado" couldn't help but flinch at the sight of the infamous flag. --- Jack allowed the silence to stretch, savouring the fear that radiated from the other ship like heat waves. Then, a slow, cruel smile spread across his face. "See, lads," he drawled, his voice dripping with mock sympathy, "sometimes the best weapon is a good scare." --- The element of surprise, meticulously orchestrated by Jack, had done its job. The pirates of the "Revenge" might not have fired a single shot yet, but the battle was already half-won. The legend of Calico Jack and his fearsome Jolly Roger would echo through the Caribbean for years to come, a chilling reminder that sometimes, the most terrifying weapon is a symbol. --- This file is made by RootOfAllLight available under the Creative Commons CC0 1.0 Universal Public Domain Dedication

Customer Reviews

4.6 out of 5 stars rating134 Total Reviews
107 total 5-star reviews13 total 4-star reviews8 total 3-star reviews3 total 2-star reviews3 total 1-star reviews
134 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous23 April 2025Verified Purchase
Metal Cage Dartboard
Could not be happier about this dart board. Excellent price and it looks exactly as designed and is well made.
from zazzle.com (US)
5 out of 5 stars rating
By Angeline H.11 August 2023Verified Purchase
Metal Cage Dartboard
Zazzle Reviewer Program
Was exactly what I wanted for his retirement gift. I knew that the quality of the image wasn't the best but it turned out to be awesome
5 out of 5 stars rating
By Kim d.17 December 2022Verified Purchase
Metal Cage Dartboard
Zazzle Reviewer Program
I am so please with the quality of this dartboard and the image is awesome!! My son was in the MC and I can't wait to give this to him for Christmas! The printing is perfect!
from zazzle.com (US)

Tags

Dartboards
skullskullsswordscalico jackjohn rackhampirateflagpiracyraiderhigh seas
All Products
skullskullsswordscalico jackjohn rackhampirateflagpiracyraiderhigh seas

Other Info

Product ID: 256380692942737715
Posted on 28/05/2024, 4:36 PM
Rating: G