Tap / click on image to see more RealViewsTM
Sale Price $52.52.  
Original Price $58.35 per shirt
You save 10%

Wine Winemaker Grapevine Grape T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: Black

    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Wine Winemaker Grapevine Grape T-Shirt

Wine Winemaker Grapevine Grape T-Shirt

A super grapevine drawing for winemakers and wine lovers who like grapevines. A great design idea also for hobby gardeners who like to grow wine. The grapevine is a great motif for winemakers and wine connoisseurs who love their grapes.

Customer Reviews

4.7 out of 5 stars rating32.4K Total Reviews
25370 total 5-star reviews4928 total 4-star reviews1115 total 3-star reviews500 total 2-star reviews482 total 1-star reviews
32,395 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Jarrod H.28 May 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Small
I found the shirt quality itself to be well made. Unfortunately I found that the image quality of the artwork is low resoultion. So the art and words aren't as clear. I probably wont buy another shirt to be honest, but I'm glad I supported the podcast of which I'm a fan of. I was just hoping that for the price I paid, it would have been of better quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By B M.24 December 2022Verified Purchase
Basic Dark T-Shirt, Black, Small
Zazzle Reviewer Program
this was good quality and perfect colour. Printing was great although when we all opened our secret santa gifts one of the other mechanics commented whoever got that for him missed out part time after the word mechanic Sorry I don't have any photos
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous21 November 2024Verified Purchase
Basic Dark T-Shirt, Black, Large
The T-Shirt I ordered arrived promptly and in good condition. My partner loved it. Very pleased with this purchase. Fay B.

Tags

winegrapevinewinemakerslikegreatmotifconnoisseurstheirgrapesfarmer

Other Info

Product ID: 235321457657820985
Posted on 4/01/2022, 11:59 AM
Rating: G