Tap / click on image to see more RealViewsTM
$15.50
per set of 3 sheets
 

winter flakes holidays motif wrapping paper sheet

Collection
Qty:

Other designs from this category

Shop this collection

Rodica Ichim
snowflake partyDesigned by Rodica Ichim
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Wrapping Paper Sheet Sets

Sold by

Size: 48 cm x 73 cm

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customisable! Mix and match designs to create unique combinations
  • Dimensions: (3) 48 cm x 73 cm sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

winter flakes holidays motif wrapping paper sheet

winter flakes holidays motif wrapping paper sheet

ice flakes winter holidays motif

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
1005 total 5-star reviews48 total 4-star reviews19 total 3-star reviews4 total 2-star reviews26 total 1-star reviews
1,102 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nicky B.4 September 2025Verified Purchase
Extremely good quality wrapping - perfect for what I needed. .
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Fi S.24 March 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte
Zazzle Reviewer Program
So happy with the product. They warned it could be blurry on printing but I love it and there’s no blurriness at all. So good! It very clear :)
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.8 December 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte
Zazzle Reviewer Program
Love the design! Would 100% recommend it! Looks exactly as the pictures! Perfect! 😊

Tags

All Products
wintersnowflakeschristmaspatterngreywhiteholidays

Other Info

Product ID: 256145392692077870
Posted on 1/10/2022, 11:51 PM
Rating: G