Tap / click on image to see more RealViewsTM
$18.55
per sheet of 20
 

Winter Snowflake Christmas sticker

Qty:

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Winter Snowflake Christmas sticker

Winter Snowflake Christmas sticker

Featuring a beautifully detailed snowflake and the classic message “Merry Christmas,” this design brings seasonal charm to gift bags, wrapped presents, envelopes, party favors, and holiday packaging. The crisp winter motif and clean typography make it perfect for both modern and traditional Christmas themes. Whether you’re personalizing family gifts, creating custom holiday treats, or adding a professional touch to handmade items, these stickers make your presents look extra special. A simple, stylish, and joyful way to share the spirit of the season! Perfect for: 🎁 Gift wrapping ❄️ Holiday party favors 📦 Small business packaging 💌 Christmas cards & envelopes Spread cheer with every gift you give!

Customer Reviews

4.8 out of 5 stars rating26.9K Total Reviews
23263 total 5-star reviews2197 total 4-star reviews569 total 3-star reviews358 total 2-star reviews543 total 1-star reviews
26,930 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa T.23 November 2020Verified Purchase
Zazzle Reviewer Program
Stickers had a glossy finish which gave them a very professional look. The colour is perfect. And they are the exact size of my lip balm lids. Printing is crisp and clear. Will definitely be ordering again.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie O.18 February 2024Verified Purchase
Zazzle Reviewer Program
The label is the perfect size , great quality as a label for a glass jar and the product was just as it looked on line and arrived within a very quick timeframe. The design was just perfect tasteful artistic and I have received so many comments from people on the label . A perfect size, colour and font very professional.
5.0 out of 5 stars rating
5 out of 5 stars rating
By alisha s.17 September 2024Verified Purchase
Came in exactly a week. They look great. Using these for my son's Army themed party. Thank you!

Tags

Stickers
giftwrappingchristmasstickertagsnowflakemerryhoildayredsnowflakes
All Products
giftwrappingchristmasstickertagsnowflakemerryhoildayredsnowflakes

Other Info

Product ID: 256743275812021445
Posted on 7/12/2025, 2:43 PM
Rating: G